Description

Buy CJC 1295 no DAC 5mg Online

Unlock Advanced Endocrine Research with High-Purity CJC-1295 No DAC (5mg)

Welcome to eupeptideshop.org, your premier source for premium research peptides in the European Union. We understand the critical need for stringent quality control and reliable sourcing in scientific research. That is why we are proud to offer our rigorously tested CJC-1295 No DAC (5mg) , a synthetic peptide derivative of Growth Hormone-Releasing Hormone (GHRH), also known as Modified GRF (1-29) .

For researchers across Germany, France, the Netherlands, Spain, and the broader EU, our CJC-1295 No DAC provides the precision and purity required for studying hormonal axes, cellular signaling, and peptide-receptor interactions.

Product Overview: The Role of CJC-1295 No DAC in Research

CJC-1295 is a synthetic analog of GHRH designed to stimulate the release of growth hormone (GH) from the anterior pituitary gland . Unlike its counterpart CJC-1295 with DAC (Drug Affinity Complex), the “No DAC” variant lacks the albumin-binding moiety. This results in a significantly shorter half-life, allowing researchers to study the physiological effects of pulsatile GH release rather than sustained elevation . This distinction is crucial for researchers investigating the nuanced dynamics of endocrine feedback loops and the temporal effects of GHRH stimulation.

Our 5mg vial is the ideal quantity for laboratory settings, ensuring you have a fresh supply for your in vitro and in vivo experimental models without unnecessary waste.

Technical Specifications and Physicochemical Data

For research to be valid, the reagents must be characterized. Our CJC-1295 No DAC meets the highest industry standards. Below are the verified specifications based on comprehensive analysis .

• Molecular Formula: C₁₅₂H₂₅₂N₄₄O₄₂

• Molecular Weight: Approximately 3367.9 g/mol

• CAS Number: 446036-97-1

• Synonyms: Modified GRF (1-29), CJC-1295-no DAC, GHRH (1-29)-NH2

• Purity: ≥98% (Verified by HPLC and MS)

• Appearance: White or off-white lyophilized (freeze-dried) powder

• Sequence (One-Letter Code): YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2

• Sequence (Three-Letter Code): Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2

Solubility, Stability, and Storage Guidelines

Proper handling is essential to maintain peptide integrity. Adhere strictly to the following protocols to ensure experimental reproducibility.

Solubility Profile
CJC-1295 No DAC is soluble in aqueous solutions. For best results:

• Recommended Solvent: Sterile water for injection or bacteriostatic water.

• Alternative Solvents: For stock solutions, DMSO (1 mg/mL) can be used, though it is slightly soluble in DMF and ethanol . To increase solubility, warm the tube to 37°C and use an ultrasonic bath briefly .

Storage Conditions

• Lyophilized Powder (Long-Term): Store at -20°C. Under these conditions, the peptide is stable for up to 24 months .

• Stock Solution (In Use): Once reconstituted, store the peptide solution in a refrigerator at 2-8°C. Use within 30 days to avoid degradation .

• Handling: Avoid repeated freeze-thaw cycles. It is recommended to aliquot the stock solution into separate vials to prevent product failure .

Reconstitution and Research Application Protocols

Reconstitution Guidelines

1. Preparation: Allow the vial to reach room temperature. Clean the rubber stopper with an alcohol swab.

2. Diluent: Using a sterile syringe, slowly inject 1-2 mL of bacteriostatic water (0.9% benzyl alcohol) into the vial. Aim the stream against the glass wall to avoid excessive foaming .

3. Mixing: Do not shake vigorously. Gently swirl or roll the vial until the powder is completely dissolved and the solution becomes clear .

Known Research Applications
CJC-1295 No DAC is widely utilized in endocrinology and molecular biology for:

• GHRH Signaling Pathways: Investigating the activation of G-protein-coupled receptors (GHS-R and GHRHR) .

• Gene Expression: Analyzing changes in the expression of regulatory proteins and factors in cell cultures .

• Hypothalamic-Pituitary Axis: Studying the regulation of the endocrine axis in controlled experimental models .

• Cellular Response: Evaluating the dynamics of cellular responses to peptide stimuli .

• Safety Considerations: All handling should be performed in a laboratory setting wearing appropriate personal protective equipment (gloves, lab coat, eye protection). This product is strictly for research use and is not for human consumption or veterinary use .

Why Purchase CJC-1295 No DAC from EU Peptide Shop?

When you choose to buy CJC 1295 no DAC 5mg online from us, you are selecting a partner dedicated to scientific excellence.

• EU Compliant: All our products, including our “research chemicals EU compliant” inventory, are sourced and handled in accordance with EU regulations for chemical reagents.

• Uncompromised Purity: We provide comprehensive HPLC/MS data to verify our ≥98% purity specifications, a critical requirement for serious research.

• Premium Packaging: Your peptide arrives in sterile, sealed vials, packaged securely to maintain stability during transit. We ensure fast, discreet delivery across Europe, including Germany, France, Netherlands, and Spain.

• Trusted Supplier: We are recognized as a leading “peptide supplier Spain” and the rest of Europe, trusted by research facilities and laboratories for our consistency and service.

---

Frequently Asked Questions: CJC-1295 No DAC (5mg)

1. What is the difference between CJC-1295 No DAC and CJC-1295 with DAC?

The primary difference lies in the half-life. CJC-1295 No DAC (also known as Modified GRF 1-29) lacks the Drug Affinity Complex. This means it is cleared from the bloodstream more rapidly, mimicking the natural pulsatile release of growth hormone. CJC-1295 with DAC binds to albumin and stays active much longer, providing sustained levels. For researchers studying acute signaling events, the “No DAC” version is often the preferred tool .

2. How should I store my CJC-1295 5mg upon arrival to maintain stability?

Upon receiving your order from eupeptideshop.org, you should store the lyophilized peptide in a freezer at -20°C. It is stable in this state for an extended period. Once you reconstitute the peptide with bacteriostatic water for research, it should be stored in the refrigerator at 2-8°C and used within 30 days .

3. Do you ship CJC-1295 No DAC to Germany, France, and Spain?

Yes. We specialize in “buy peptides EU” and offer rapid, reliable shipping across the continent. Whether you are in Berlin, Lyon, Amsterdam, or Madrid, our logistics network ensures your laboratory peptides Netherlands or peptides for research France arrive safely and discreetly. We are a trusted peptide supplier Spain and throughout Europe.

4. What purity level can I expect from your CJC-1295 No DAC?

We guarantee a purity of ≥98% . Each batch is subjected to rigorous High-Performance Liquid Chromatography (HPLC) and Mass Spectrometry (MS) analysis. This commitment to “high purity peptides Germany” standards ensures that your research data is not compromised by impurities. Certificates of Analysis are available upon request.

5. Is CJC-1295 No DAC compliant with EU research chemical regulations?

Absolutely. We operate as a premium UE-based online retailer. All our offerings, including GLP-1 research peptides EU and our extensive catalog, are sold strictly as “research chemicals EU compliant.” They are intended for laboratory use only and are not for human consumption, aligning with the REACH classifications for chemical reagents .

6. What is the correct way to reconstitute CJC-1295 No DAC powder?

To reconstitute, use bacteriostatic water or sterile water. Draw the water into a sterile insulin syringe and inject it slowly against the inner wall of the vial. Do not shake vigorously; instead, gently roll the vial between your hands until the solution is clear. This prevents damage to the peptide structure .

7. Can I use this product for in vivo research?

CJC-1295 has been documented in scientific literature for use in animal models via subcutaneous injection . Our product is sold as a high-purity research reagent suitable for such studies, provided your facility has the proper ethical approvals for in vivo experimentation. Always adhere to your local guidelines for peptide synthesis Europe and animal research protocols.

8. Do you offer other research peptides like BPC-157 or Ipamorelin?

Yes, we carry a full range of research peptides. You can browse our catalog for BPC-157 Europe stock, as well as popular combinations like CJC-1295 with Ipamorelin for synergistic research applications .

9. What is the molecular weight of CJC-1295 No DAC?

The molecular weight is approximately 3367.9 g/mol . This is a critical parameter for molarity calculations when preparing your dosing solutions.

10. Is the amino acid sequence for CJC-1295 No DAC amidated?

Yes. The C-terminus of our peptide features an amide group (-NH2), which is indicated by the sequence ending in …ILSR-NH2 . This modification often enhances stability and bioactivity in biological systems. ........ .. ..  google